Search
2018/12/04 14:15
Lactic acid bacteria are a general term for bacteria that can produce large amounts of lactic acid from fermentable carbohydrates. These bacteria are widely distributed in nature and are rich in species diversity. Any bacterium that produces lactic acid from the fermentation of glucose or lactose is collectively referred to as lactic acid bacteria.
2018/12/04 14:01
Jinwei Beverage & Food Co., Ltd. was established in 1990. It has two production bases, Shilong Head Office and Huangzhou Branch. It has 8 production workshops and more than ten production lines. It is equipped with product R&D center and product inspection. room.
2018/12/04 13:55
In fact, in addition to taking drugs, there is a way to help or relieve constipation, which is to take probiotics for a long time. The world's most studied probiotic strain, Lactobacillus rhamnosus (LGG), which is resistant to stomach acid and can reach the intestine. Its unique adhesion protein makes it adhere to the intestines, helps the body to digest, maintains intestinal health and promotes immunity.
2018/12/04 13:53
Foodsupplement:Ihavepassedthespringofhigheczema,andIhaveusheredintheworstsummerheatofmybaby'sappetite.Manybabiescan'teathalfoftheminthesummerandeatandeat.Infact,summeranorexiaandindigestionarephenomenathatmanychildrenwillappear.Intheend,thisisbecausethebaby'sstomachisweak.Whentheseasonischanged,therewillbestomachupsetandeasytogetsick.Therefore,mothersshouldgiveprobioticstotheirchildrenassoonaspossible.KetchupLeprobioticisanexcellentprobioticproductthatusesLGG(Lactobacillusrhamnosus),whichisresistanttostomachacidandcanreachtheintestines.Ithasauniqueadhesionproteinthatmakesitsticky.Itisattachedtotheintestinestohelptheintestinesrestorethenaturalbalanceofbeneficialbacteriaandharmfulbacteria.Itcanalsobecolonizedintheintestinefor1-2weekstoimproveintestinalimmunityandpromotethelong-termhealthofthebaby'sintestines.Allergy/Eczema:KangCuiLehasgivenagoodsolutiontotheproblemofhowtodealwithbabyskinsensitivity.Byoralprobiotics,itcanimprovethestabilityofthehealthyintestinalflora,therebyenhancingthebaby'simmunityandreducingskinsensitivityandeczema.WiththehelpofKangquLeprobiotics,themothernolongerneedstobesensitivetothebaby'sskin,andhowtodoitwitheczema,thebabywillgrowuphealthilyandvigorously.LGGprobioticsareclinicallyprovenstrainsthatcaneffectivelyimprovetheimmunityofinfantsandyoungchildren.InadditiontocontainingasufficientamountofLGGstrain,theextractofProbioticshasaddedchamomileextract,vitaminDandotheringredientstobettersupplementthenutrientsneededforthebaby'sgrowthandtocalmthebaby'smoodandhelp.Babywithsensitiveskinandeczemarecoversassoonaspossible.Getangry:Manynewbornbabiesarepronetofire,lossofappetite,bloating,etc.Thisisoftencausedbydisordersofthedigestivesystem.ManypeopleknowthattakingprobioticsisakindofAneffectivewaytoimprove,andthemostpopularistheProcter&Gamble.ThechamomiledropsintheProbioticsaddLGGlivebacteriawhileaddingsomechamomileextractstohelpthebabysoothethemood,easetheanxietyinthesummer,andreducethebabycrying.Atthesametime,alargenumberofprobioticsalsosignificantlyimprovethebaby'sdigestivecapacity,andtheproblemoflossofappetitehasbeenimproved.Basically,constipation,largefireandothersymptomscanbesignificantlyimprovedafteradheringtotheuseofKanglixileprobioticsforaperiodoftime.TheProbioticsProstheticsstandoutinthesameclassofprobiotics.Itnotonlyhelpsyourbabybuildahealthierandmorestableintestinalsystem,butalsoboostsimmunity.Aftertakingthebaby,thesymptomsofgettingangrywilldefinitelyimprove,andatthesametimehelpthebabygrowuphealthilyandvigorously.Thebabyislesssickandthemotherismoreatease.